PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000480547
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 256aa    MW: 29123.7 Da    PI: 8.459
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000480547genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.63.4e-30195253159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDg++WrKYG+K+vk+s++pr+YY+C+  gC+vkk+ver++edp++v++tY g Hnh+
  MDP0000480547 195 LDDGFRWRKYGKKKVKSSPNPRNYYKCSVGGCHVKKRVERDREDPRFVITTYDGVHNHP 253
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.4E-32181253IPR003657WRKY domain
SuperFamilySSF1182901.44E-26188253IPR003657WRKY domain
PROSITE profilePS5081130.274190255IPR003657WRKY domain
SMARTSM007749.2E-33195254IPR003657WRKY domain
PfamPF031062.3E-23196253IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MEEEIAELGL GXGSVNSKEE DVAVTIAGLR EKSRSRRTKH DQEQQDTIKI KNTINGSKKM  60
KRCXEKQEKR IEEETSDWTW SNHEPETFQG TKSTHKSSFG MSVESPETND FSGXLNFEFS  120
EYLMIRKWLD EDPSFVGSEF SVQXSGFRAN EVGESGARSS QPGGSTIRGX XGSSRERQEA  180
RERVAFKTKS EVEILDDGFR WRKYGKKKVK SSPNPRNYYK CSVGGCHVKK RVERDREDPR  240
FVITTYDGVH NHPGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-25185252774Probable WRKY transcription factor 4
2lex_A3e-25185252774Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.255031e-168bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334707.11e-100PREDICTED: probable WRKY transcription factor 50
SwissprotQ8VWQ51e-41WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA5AQ486e-52A5AQ48_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g01470.t014e-51(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.13e-41WRKY DNA-binding protein 50